PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK14402.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family G2-like
Protein Properties Length: 408aa    MW: 45390.4 Da    PI: 6.7613
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK14402.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17e-32272327156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+ eLH+rFv+a++qLGGs++AtPk+i+elm v+gLt+++vkSHLQkYRl+
  PK14402.1 272 KQRRCWSIELHRRFVDAIHQLGGSHVATPKQIRELMRVEGLTNDEVKSHLQKYRLH 327
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.423269329IPR017930Myb domain
SuperFamilySSF466891.02E-16270330IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28271330IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-25272327IPR006447Myb domain, plants
PfamPF002497.7E-7274325IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MELSLNNNSG LAFVPKTISE FLEHVSKIRD GSEKLSKLDD YVKRFEEEKR KIDAFKRELP  60
LCMSLVTDAI ERLKEEEKAI KAMDEFTSFK GNSDENGSTN LVDDSCDKKS WMSSAQLWST  120
NVVDCDSHNK QTSVSELKPR IEEVAVDRHV SEKQPIGVSD YRNRGGAFVP FKAQPSPPSG  180
VIVRTSLKED KEVSLSRVPS LSLMPPTPLP TTSPISEMGG TSGDSNPKSS HSCKTGSASS  240
FLTEQVKLVS KSQLVQHQTQ HQHHQQQQPF RKQRRCWSIE LHRRFVDAIH QLGGSHVATP  300
KQIRELMRVE GLTNDEVKSH LQKYRLHVRK LPNSSTEPDS GLWMSQDQCG DSSHQSASPQ  360
GPLAPSGSNK ALSHTGGNST EVEDEEEDEK SDGHSWRGGN HNKAGEDV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBM25215497Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890038.11e-134PREDICTED: uncharacterized protein LOC107424698
TrEMBLW9S3N81e-129W9S3N8_9R
STRINGVIT_07s0197g00060.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.14e-33G2-like family protein